PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01073.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family B3
Protein Properties Length: 316aa    MW: 36037.5 Da    PI: 9.6027
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01073.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B362.85.3e-2023118199
                              EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE...EEE-TTHHHHHHHHT--TT-EEEEE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr...yvltkGWkeFvkangLkegDfvvFk 83 
                              ffkv      ++s+ lv+p  f+ ++ ++k+ + +++l de grsW+v+ + + + +r   +v++kGW +F++++ L+ gDf+vF+
  Rsa1.0_01073.1_g00001.1  23 FFKVY--LPEFNSRELVIPPAFI-NI-LEKPLPNQVVLADEIGRSWNVETKTEDTEERvgvVVFKKGWGKFANDHSLEFGDFLVFS 104
                              77777..67888899********.44.5567999****************88666666788************************* PP

                              E-SSSEE..EEEEE-S CS
                       B3  84 ldgrsefelvvkvfrk 99 
                              +dg s+f   v++f+k
  Rsa1.0_01073.1_g00001.1 105 HDGVSRF--SVTIFDK 118
                              9999999..9*99998 PP

2B340.45.2e-13210288990
                              HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                       B3   9 dvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                               +++++++ +p +f++++g++ ee  ++ l de+g++W++k+ +  +++r+   + W +F+++++L +   ++F+++ rs++
  Rsa1.0_01073.1_g00001.1 210 TTGSRRQMDIPTTFLKSNGIEMEE--DIELCDENGKKWRMKIVIHDRGQRF-SPGLWLSFCQSHKLTTSNKCLFEFIVRSNG 288
                              5688999***********988766..79999***********776666665.5668*******************8754333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086314.35321119IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.8E-2222121IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-2222121IPR015300DNA-binding pseudobarrel domain
PfamPF023624.3E-1823119IPR003340B3 DNA binding domain
CDDcd100171.20E-1823117No hitNo description
SMARTSM010192.0E-1923119IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-16198297IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.34E-16198295IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.139202301IPR003340B3 DNA binding domain
CDDcd100171.66E-9203298No hitNo description
SMARTSM010191.1E-12205301IPR003340B3 DNA binding domain
PfamPF023623.4E-11210288IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MVETSGKVSS SPSSFYARRD LEFFKVYLPE FNSRELVIPP AFINILEKPL PNQVVLADEI  60
GRSWNVETKT EDTEERVGVV VFKKGWGKFA NDHSLEFGDF LVFSHDGVSR FSVTIFDKNG  120
CRKDLVAVPT RADRSRVAVE KEPVLVKPFA DISTKRCGKS LKRVSVKEEP SGNRVRDPCE  180
MGWVPEKKKL KGFEEPVYKP KNPHFVRNIT TGSRRQMDIP TTFLKSNGIE MEEDIELCDE  240
NGKKWRMKIV IHDRGQRFSP GLWLSFCQSH KLTTSNKCLF EFIVRSNGAC NQVLVRIFGG  300
TMLTTVTRNS YQVLAM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013659243.11e-177PREDICTED: putative B3 domain-containing protein At5g66980 isoform X1
SwissprotQ9FGD21e-123Y5698_ARATH; Putative B3 domain-containing protein At5g66980
TrEMBLA0A0D3E2J71e-177A0A0D3E2J7_BRAOL; Uncharacterized protein
STRINGBra037132.1-P1e-174(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM128022130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.11e-117B3 family protein